PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_9.288
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family FAR1
Protein Properties Length: 209aa    MW: 23619.6 Da    PI: 7.0085
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_9.288genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR190.62.1e-2845132289
                         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtklel 83 
                                  fY++YA++vGF +r+ +s+ks+r+g+i++r++ C+keg++ ++k+  + + r+++++r gC a+++vk+ek g+w vtk+++
  evm.model.supercontig_9.288  45 FYDDYARQVGFFTRIVSSQKSERDGSIISRRLACNKEGFNLSSKTGGKIRIRKQESKREGCMAMIVVKREKPGQWIVTKFVK 126
                                  9*******************************************99899999****************************** PP

                         FAR1  84 eHnHel 89 
                                  +HnH+l
  evm.model.supercontig_9.288 127 DHNHPL 132
                                  *****9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-2545133IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
METLIEDKFV TSSTRGESGA SCETETTQEP CQGMIFDSEQ AAKAFYDDYA RQVGFFTRIV  60
SSQKSERDGS IISRRLACNK EGFNLSSKTG GKIRIRKQES KREGCMAMIV VKREKPGQWI  120
VTKFVKDHNH PLLVSSTNGG QTSDDKDMKI KELSSELHHA NQFLDTCREQ LRVLMTYIEE  180
HIGCLSRTVE NAVQNIREIE SKNQTEQQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003632074.21e-105PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL82e-22FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLF6HYS11e-105F6HYS1_VITVI; Putative uncharacterized protein
STRINGVIT_05s0102g00390.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1929477
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.12e-54FAR1 family protein